PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla016349
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NAC
Protein Properties Length: 153aa    MW: 18026.7 Da    PI: 9.6792
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla016349genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.41.9e-5581361128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                +ppGfrFhPt+eelv +yLk+k++++k++l +vi ++d+yk+ePwd+++     ++e+kewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk+vls k+
  Cla016349   8 VPPGFRFHPTEEELVGYYLKRKINSQKIDL-DVIIDIDLYKMEPWDIQAnckFGYEEQKEWYFFSHKDRKYPTGTRTNRATSAGFWKATGRDKAVLS-KN 105
                69****************************.99**************953432234677**************************************.89 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                +++g++ktLvfykgrap+g+ktdW+mheyrl
  Cla016349 106 RVIGMRKTLVFYKGRAPNGRKTDWIMHEYRL 136
                99***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.72E-586141IPR003441NAC domain
PROSITE profilePS5100554.4178153IPR003441NAC domain
PfamPF023658.4E-309136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009741Biological Processresponse to brassinosteroid
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0050832Biological Processdefense response to fungus
GO:0071365Biological Processcellular response to auxin stimulus
GO:0090059Biological Processprotoxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MEILESCVPP GFRFHPTEEE LVGYYLKRKI NSQKIDLDVI IDIDLYKMEP WDIQANCKFG  60
YEEQKEWYFF SHKDRKYPTG TRTNRATSAG FWKATGRDKA VLSKNRVIGM RKTLVFYKGR  120
APNGRKTDWI MHEYRLQTSE LAPVQASFLL TSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-52513612140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00017PBMTransfer from AT1G71930Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817961e-123LN681796.1 Cucumis melo genomic scaffold, anchoredscaffold00065.
GenBankLN7132551e-123LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008461973.11e-95PREDICTED: NAC domain-containing protein 7-like
RefseqXP_011001778.14e-95PREDICTED: NAC domain-containing protein 7-like isoform X2
RefseqXP_011001780.14e-95PREDICTED: NAC domain-containing protein 7-like isoform X2
SwissprotQ9C8W92e-94NAC30_ARATH; NAC domain-containing protein 30
TrEMBLA0A0A0K4F08e-95A0A0A0K4F0_CUCSA; Uncharacterized protein
TrEMBLB9MW799e-95B9MW79_POPTR; No apical meristem family protein
STRINGPOPTR_0013s11740.12e-94(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71383247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.12e-88vascular related NAC-domain protein 7